Worry-free aftermarket FOXO4

Company Details

Shaanxi YXchuang Biotechnology Co., Ltd
[Shaanxi,China]
Business Type:Manufacturer , Trade Company
Main Markets: Africa , Americas , Asia , Caribbean , East Europe , Europe , Middle East , North Europe , Oceania , Other Markets , West Europe , Worldwide
Exporter:61% - 70%
Certs:COS, HACCP, ISO/TS16949, ISO9001, ISO9002, ACS, EMC, PSE, REACH

Inquiry Basket ( 0 )

Shaanxi YXchuang Biotechnology Co., Ltd

Home > News > Worry-free aftermarket FOXO4

Online Service

Contact Person: Ms. Ella
View Contact Details

Contact Now

News

Worry-free aftermarket FOXO4

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Share to:

Previous: resveratrol for high speed shipping Next: Best quality Tryptamine 61-54-1

Communicate with Supplier?Supplier

Ella

Ms. Ella
What can I do for you?

Contact Supplier