Product Information:
Peptide Powder FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI Bodybuilding Powder was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 of Bodybuilding Raw Powder DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Function:
FOXO4 Peptide Powder D-Retro-Inverso (DRI) is a cell penetrating peptide shown to selectively induce apoptosis of senescent cells thereby
reversing effects of aging in mice.
Product Photo:
Our company offers variety of products which can meet your multifarious demands.including API Powder、Pharmaceutical Intermediates、Vitamins Powder、Plant Extracts、Food Additive、Peptide Powder and so on We adhere to the management principles of "quality first, customer first and credit-based" since the establishment of the company and always do our best to satisfy potential needs of our customers. Our company is sincerely willing to cooperate with enterprises from all over the world in order to realize a win-win situation since the trend of economic globalization has developed with anirresistible force.
About us:
Company Profile:
Jxchuang today it has been graduallymove from singleness to high-tech mode enterprise, focusing on production,R&D, Sales andOEM. A large-scale enterprise with 55,000 square meter of modernized new factory buildings andoffice buildings, 35,000 square meter standardized clean room, 100,000 grade cleaned room, and2000 square meter high standard laboratory.
Certification:
Payment Term and Packing Delivery:
FAQ:
Q1: Are you a manufacturer?
Answer: Yes
Q2: How to contact with us?
Click the Google "Contact Supplier" And then send us message the product you interest in, you will get reply within 24 hours.
Q3:Which kind of payment terms do you accept?
For small order,you can pay by T/T,Western Union or online ,nomal order by T/T to our company account
Q4:Can you give me a discount price?
Surely,It depend on your qty
Q5:How can i get a sample?
free samples is available,but freight charges will be at your account and the charges will be return to you or deduct from your order in the future.
Q6: How to confirm the Product Quality before placing orders?
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
Q7:How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.
Product Categories : API Powder > N Isopropylbenzylamine
